Antibodies

Jump to Filters
View as table Download
IMMP2L (Center) Rabbit Polyclonal Antibody
AP52204PU-N

USD 450.00

2 Weeks

IMMP2L (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 88~117 amino acids from the Central region of Human IMMP2L
IMMP2L Rabbit Polyclonal Antibody
TA342985

USD 375.00

5 Days

Rabbit Polyclonal Anti-IMMP2L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IMMP2L antibody: synthetic peptide directed towards the N terminal of human IMMP2L. Synthetic peptide located within the following region: LNPGGSQSSDVVLLNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALE
IMMP2L Rabbit Polyclonal Antibody
TA342986

USD 375.00

5 Days

Rabbit Polyclonal Anti-IMMP2L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IMMP2L antibody: synthetic peptide directed towards the C terminal of human IMMP2L. Synthetic peptide located within the following region: GHSFDSNSFGPVSLGLLHAHATHILWPPERWQKLESVLPPERLPVQREEE