USP12 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 222-251 amino acids from the Central region of human USP12 |
USP12 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 222-251 amino acids from the Central region of human USP12 |
Rabbit Polyclonal Anti-USP12 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-USP12 Antibody: synthetic peptide directed towards the middle region of human USP12. Synthetic peptide located within the following region: ITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNG |
Carrier-free (BSA/glycerol-free) USP12 mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) USP12 mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USP12 mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USP12 mouse monoclonal antibody,clone 1E3, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USP12 mouse monoclonal antibody,clone 1E3, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USP12 mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USP12 mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USP12 mouse monoclonal antibody,clone 2A6, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USP12 mouse monoclonal antibody,clone 2A6, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USP12 mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".