Antibodies

Jump to Filters
View as table Download
BRD3 Rabbit Polyclonal Antibody
TA343672

USD 410.00

2 Weeks

Rabbit Polyclonal Anti-BRD3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BRD3 antibody: synthetic peptide directed towards the N terminal of human BRD3. Synthetic peptide located within the following region: MSTATTVAPAGIPATPGPVNPPPPEVSNPSKPGRKTNQLQYMQNVVVKTL
BRD3 Rabbit Polyclonal Antibody
TA343673

USD 475.00

5 Days

Rabbit Polyclonal Anti-BRD3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BRD3 antibody: synthetic peptide directed towards the middle region of human BRD3. Synthetic peptide located within the following region: ASGKKQAAKSKEELAQEKKKELEKRLQDVSGQLSSSKKPARKEKPGSAPS
BRD3 Rabbit Polyclonal Antibody
TA335661

USD 375.00

5 Days

Rabbit Polyclonal Anti-BRD3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-BRD3 Antibody: synthetic peptide directed towards the middle region of human BRD3. Synthetic peptide located within the following region: SGKKQAAKSKEELAQEKKKELEKRLQDVSGQLSSSKKPARKEKPGSAPSG
BRD3 Rabbit Polyclonal Antibody
TA314713

USD 345.00

4 Weeks

Rabbit polyclonal anti-BRD3 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BRD3.