Antibodies

Jump to Filters
View as table Download
Fibulin 1 (FBLN1) Rabbit Polyclonal Antibody
TA346314

USD 475.00

5 Days

Rabbit Polyclonal Anti-FBLN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBLN1 antibody: synthetic peptide directed towards the N terminal of human FBLN1. Synthetic peptide located within the following region: CCVKSQETGDLDVGGLQETDKIIEVEEEQEDPYLNDRCRGGGPCKQQCRD
Fibulin 1 (FBLN1) Rabbit Polyclonal Antibody
TA323077

USD 345.00

In Stock

Anti-FBLN1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 159-172 amino acids of Human fibulin 1
Fibulin 1 (FBLN1) Rabbit Polyclonal Antibody
TA323078

USD 345.00

In Stock

Anti-FBLN1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 159-173 amino acids of Human fibulin 1