Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal MUC-1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit polyclonal anti-PGRMC2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human PGRMC2. |
Rabbit Polyclonal MUC1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | MUC1 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human MUC1. The immunogen is located within the last 50 amino acids of MUC1 . |
Active filters
Target Symbol
- MUC1
Reactivities
- Mouse
Families
- Secreted Protein