Antibodies

View as table Download

Rabbit Polyclonal CCDC134 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CCDC134 antibody was raised against a 17 amino acid peptide near the amino terminus of human CCDC134.

Rabbit Polyclonal Anti-CCDC134 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CCDC134 Antibody is: synthetic peptide directed towards the C-terminal region of Human CCDC134. Synthetic peptide located within the following region: GISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPS