Rabbit Polyclonal CCDC134 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CCDC134 antibody was raised against a 17 amino acid peptide near the amino terminus of human CCDC134. |
Rabbit Polyclonal CCDC134 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CCDC134 antibody was raised against a 17 amino acid peptide near the amino terminus of human CCDC134. |
Rabbit Polyclonal Anti-CCDC134 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CCDC134 Antibody is: synthetic peptide directed towards the C-terminal region of Human CCDC134. Synthetic peptide located within the following region: GISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPS |