Antibodies

Jump to Filters
View as table Download
CMA1 Rabbit Polyclonal Antibody
TA342809

USD 375.00

5 Days

Rabbit Polyclonal Anti-CMA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CMA1 antibody: synthetic peptide directed towards the C terminal of human CMA1. Synthetic peptide located within the following region: EVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVA
CMA1 Goat Polyclonal Antibody
TA311216

USD 375.00

5 Days

Goat Anti-CMA1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QFRHPKYNTSTLHHD, from the internal region of the protein sequence according to NP_001827.1.