Antibodies

View as table Download

Rabbit anti-LIPC Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human LIPC

Anti-LIPC Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 220 amino acids of human lipase, hepatic

Rabbit Polyclonal Anti-LIPC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LIPC antibody is: synthetic peptide directed towards the C-terminal region of LIPC. Synthetic peptide located within the following region: LKTIRVKAGETQQRMTFCSENTDDLLLRPTQEKIFVKCEIKSKTSKRKIR

LIPC Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated