Antibodies

Jump to Filters
View as table Download
CBLN4 Rabbit Polyclonal Antibody
TA316126

USD 345.00

In Stock

Rabbit polyclonal anti-CBLN4 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CBLN4.
CBLN4 Rabbit Polyclonal Antibody
TA340237

USD 375.00

5 Days

Rabbit Polyclonal Anti-CBLN4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CBLN4 antibody: synthetic peptide directed towards the C terminal of human CBLN4. Synthetic peptide located within the following region: HVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDK