Antibodies

Jump to Filters
View as table Download
CCDC134 (N-term) Rabbit Polyclonal Antibody
AP23484PU-N

USD 440.00

2 Weeks

CCDC134 (N-term) rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide - KLH conjugated
CCDC134 Rabbit Polyclonal Antibody
TA306809

USD 430.00

5 Days

Rabbit Polyclonal CCDC134 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CCDC134 antibody was raised against a 17 amino acid peptide near the amino terminus of human CCDC134.
CCDC134 Rabbit Polyclonal Antibody
TA331731

USD 375.00

5 Days

Rabbit Polyclonal Anti-CCDC134 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CCDC134 Antibody is: synthetic peptide directed towards the C-terminal region of Human CCDC134. Synthetic peptide located within the following region: GISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPS