Rabbit Polyclonal Anti-WFDC1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WFDC1 antibody: synthetic peptide directed towards the middle region of human WFDC1. Synthetic peptide located within the following region: VAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHF |
Rabbit Polyclonal Anti-WFDC1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WFDC1 antibody: synthetic peptide directed towards the N terminal of human WFDC1. Synthetic peptide located within the following region: WKRALPARLAEKSRAEEAGAPGGPRQPRADRCPPPPRTLPPGACQAARCQ |
Rabbit Polyclonal Anti-WFDC1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human WFDC1 |
Germany
Japan
United Kingdom
China
