Antibodies

Jump to Filters
View as table Download
VAMP8 Rabbit Polyclonal Antibody
TA342644

USD 375.00

5 Days

Rabbit Polyclonal Anti-VAMP8 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Vamp8 antibody is: synthetic peptide directed towards the middle region of Rat Vamp8. Synthetic peptide located within the following region: LDHLRNKTEDLEATSEHFKTTSQKVARKFWWKNVKMIVIICVIVLIILIL