Antibodies

View as table Download

Rabbit polyclonal PNN Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PNN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 209-239 amino acids from the Central region of human PNN.

Rabbit polyclonal anti-PNN antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PNN.

Rabbit Polyclonal Anti-PNN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PNN antibody: synthetic peptide directed towards the N terminal of human PNN. Synthetic peptide located within the following region: MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGP

Rabbit Polyclonal Anti-PNN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PNN antibody: synthetic peptide directed towards the middle region of human PNN. Synthetic peptide located within the following region: RRSVDRKRRDTSGLERSHKSSKGGSSRDTKGSKDKNSRSDRKRSISESSR

Rabbit Polyclonal Anti-PNN Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PNN