Antibodies

Jump to Filters
View as table Download
BACH1 Rabbit Polyclonal Antibody
TA312525

USD 345.00

4 Weeks

Rabbit polyclonal anti-BACH1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BACH1.
BACH1 Rabbit Polyclonal Antibody
TA335183

USD 310.00

5 Days

Rabbit Polyclonal Anti-BACH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BACH1 antibody: synthetic peptide directed towards the C terminal of human BACH1. Synthetic peptide located within the following region: PPCARGNSEPGYARGQESQQMSTATSEQAGPAEQCRQSGGISDFCQQMTD