Antibodies

View as table Download

Rabbit Polyclonal Anti-FOXQ1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXQ1 antibody: synthetic peptide directed towards the N terminal of human FOXQ1. Synthetic peptide located within the following region: PSPLSAAGDDSLGSDGDCAANSPAAGGGARDPPGDGEQSAGGGPGAEEAI

Rabbit Polyclonal Anti-FOXQ1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXQ1 antibody: synthetic peptide directed towards the N terminal of human FOXQ1. Synthetic peptide located within the following region: MKLEVFVPRAAHGDKQGSDLEGAGGSDAPSPLSAAGDDSLGSDGDCAANS

Goat Polyclonal Antibody against FOXQ1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KLEVFVPRAAHGD-C, from the N Terminus of the protein sequence according to NP_150285.

Rabbit Polyclonal Anti-FOXQ1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXQ1 antibody: synthetic peptide directed towards the N terminal of human FOXQ1. Synthetic peptide located within the following region: MKLEVFVPRAAHGDKQGSDLEGAGGSDAPSPLSAAGDDSLGSDGDCAANS

Rabbit Polyclonal Anti-FOXQ1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FOXQ1 antibody is: synthetic peptide directed towards the N-terminal region of Human FOXQ1. Synthetic peptide located within the following region: PAAGGGARDTQGDGEQSAGGGPGAEEAIPAAAAAAVVAEGAEAGAAGPGA

Rabbit Polyclonal Anti-Foxq1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Foxq1 antibody: synthetic peptide directed towards the N terminal of mouse Foxq1. Synthetic peptide located within the following region: MKLEVFVPRAAHGDKMGSDLEGAGSSDVPSPLSAAGDDSLGSDGDCAANS