Rabbit Polyclonal Anti-MED7 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MED7 antibody: synthetic peptide directed towards the middle region of human MED7. Synthetic peptide located within the following region: KRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDAD |
Rabbit Polyclonal Anti-CRSP9 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CRSP9 antibody: synthetic peptide directed towards the N terminal of human CRSP9. Synthetic peptide located within the following region: MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQ |
Rabbit Polyclonal Anti-MED7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MED7 antibody: synthetic peptide directed towards the N terminal of human MED7. Synthetic peptide located within the following region: MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQ |
Germany
Japan
United Kingdom
China
