Antibodies

View as table Download

Rabbit Polyclonal Anti-PIAS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIAS1 antibody: synthetic peptide directed towards the middle region of human PIAS1. Synthetic peptide located within the following region: LPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISL

Rabbit polyclonal PIAS1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PIAS1.

Rabbit Polyclonal Anti-PIAS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIAS1 antibody: synthetic peptide directed towards the N terminal of human PIAS1. Synthetic peptide located within the following region: MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCS

Rabbit Polyclonal Anti-PIAS1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PIAS1 Antibody: A synthesized peptide derived from human PIAS1

PIAS1 (C-term) rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen PIAS1 antibody was raised against synthetic peptide - KLH conjugated

Rabbit Polyclonal PIAS1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PIAS1 antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human PIAS1.

Rabbit Polyclonal Antibody against PIAS1 (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PIAS1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 100-130 amino acids from the N-terminal region of human PIAS1.

Rabbit Polyclonal Antibody against PIAS1 (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PIAS1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 607-637 amino acids from the C-terminal region of human PIAS1.

Rabbit Polyclonal Anti-PIAS1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PIAS1