Rabbit Polyclonal CTCF Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTCF antibody: human CTCF (CCCTC-Binding Factor), using 4 KLH coupled peptides. |
Rabbit Polyclonal CTCF Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTCF antibody: human CTCF (CCCTC-Binding Factor), using 4 KLH coupled peptides. |
Rabbit Polyclonal Anti-CTCF Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTCF antibody: synthetic peptide directed towards the N terminal of human CTCF. Synthetic peptide located within the following region: MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEV |
Rabbit Polyclonal Anti-CTCF Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTCF antibody: synthetic peptide directed towards the N terminal of human CTCF. Synthetic peptide located within the following region: GELPPQEDPSWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEE |
Rabbit polyclonal anti-CTCF (Boris) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 14 of rat BORIS |
Rabbit polyclonal anti-CTCF antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | CTCF affinity purified antibody was prepared by repeated immunizations with a synthetic peptide corresponding to a region near the C-terminus of CTCF protein. |