Rabbit Polyclonal SAP30 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SAP30 antibody: human SAP30 (Sin3-associated polypeptide, 30kDa), using the full length His-tagged protein. |
Rabbit Polyclonal SAP30 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SAP30 antibody: human SAP30 (Sin3-associated polypeptide, 30kDa), using the full length His-tagged protein. |
Rabbit Polyclonal SAP30 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SAP30 antibody: human SAP30 (Sin3-associated polypeptide, 30kDa), using the full length His-tagged protein. |
Rabbit Polyclonal Anti-SAP30 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SAP30 antibody: synthetic peptide directed towards the N terminal of human SAP30. Synthetic peptide located within the following region: MNGFTPDEMSRGGDAAAAVAAVVAAAAAAASAGNGTGAGTGAEVPGAGAV |
Rabbit Polyclonal Anti-SAP30 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SAP30 antibody: synthetic peptide directed towards the middle region of human SAP30. Synthetic peptide located within the following region: YQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNEKDTLTYF |