Antibodies

View as table Download

Rabbit polyclonal anti-MED8 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human MED8.

MED8 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 102-130 amino acids from the Central region of human MED8

Rabbit Polyclonal Anti-MED8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MED8 antibody: synthetic peptide directed towards the N terminal of human MED8. Synthetic peptide located within the following region: MQREEKQLEASLDALLSQVADLKNSLGSFICKLENEYGRLTWPSVLDSFA