Rabbit Polyclonal STAU2 Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal STAU2 Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Anti-STAU2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-STAU2 antibody is: synthetic peptide directed towards the C-terminal region of Human STAU2. Synthetic peptide located within the following region: AMLLQLGYKASTNLQDQLEKTGENKGWSGPKPGFPEPTNNTPKGILHLSP |
Rabbit Polyclonal Anti-STAU2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-STAU2 antibody is: synthetic peptide directed towards the C-terminal region of Human STAU2. Synthetic peptide located within the following region: STNLQDQLEKTGENKGWSGPKPGFPEPTNNTPKGILHLSPDVYQEMEASR |