Antibodies

Jump to Filters
View as table Download
STAU2 Rabbit Polyclonal Antibody
TA590535

USD 409.00

In Stock

Rabbit Polyclonal STAU2 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
STAU2 Rabbit Polyclonal Antibody
TA343809

USD 475.00

5 Days

Rabbit Polyclonal Anti-STAU2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-STAU2 antibody is: synthetic peptide directed towards the C-terminal region of Human STAU2. Synthetic peptide located within the following region: AMLLQLGYKASTNLQDQLEKTGENKGWSGPKPGFPEPTNNTPKGILHLSP
STAU2 Rabbit Polyclonal Antibody
TA343810

USD 475.00

5 Days

Rabbit Polyclonal Anti-STAU2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-STAU2 antibody is: synthetic peptide directed towards the C-terminal region of Human STAU2. Synthetic peptide located within the following region: STNLQDQLEKTGENKGWSGPKPGFPEPTNNTPKGILHLSPDVYQEMEASR