Antibodies

Jump to Filters
View as table Download
TOE1 (N-term) Rabbit Polyclonal Antibody
AP54328PU-N

USD 450.00

2 Weeks

TOE1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 89-117 amino acids from the N-terminal region of human TOE1
TOE1 Rabbit Polyclonal Antibody
TA340199

USD 375.00

5 Days

Rabbit Polyclonal Anti-TOE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TOE1 antibody: synthetic peptide directed towards the N terminal of human TOE1. Synthetic peptide located within the following region: VVDVQSNNFKEMWPSLLLAIKTANFVAVDTELSGLGDRKSLLNQCIEERY