GCNF (NR6A1) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 37-67 amino acids from the N-terminal region of human NR6A1 |
GCNF (NR6A1) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 37-67 amino acids from the N-terminal region of human NR6A1 |
Rabbit Polyclonal Anti-NR6A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR6A1 antibody: synthetic peptide directed towards the N terminal of human NR6A1. Synthetic peptide located within the following region: FCQDELAELDPGTISVSDDRAEQRTCLICGDRATGLHYGIISCEGCKGFF |
Carrier-free (BSA/glycerol-free) NR6A1 mouse monoclonal antibody,clone OTI6F3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NR6A1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human NR6A1 |
NR6A1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NR6A1 |
NR6A1 mouse monoclonal antibody,clone OTI6F3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
NR6A1 mouse monoclonal antibody,clone OTI6F3, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
NR6A1 mouse monoclonal antibody,clone OTI6F3, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NR6A1 mouse monoclonal antibody,clone OTI6F3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |