Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-SOX12 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SOX12. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-SOX12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SOX12 Antibody: synthetic peptide directed towards the C terminal of human SOX12. Synthetic peptide located within the following region: DCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVFTY |
Rabbit Polyclonal Anti-SOX12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SOX12 Antibody: synthetic peptide directed towards the C terminal of human SOX12. Synthetic peptide located within the following region: DCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVFTY |
Active filters
Target Symbol
- SOX12
Families
- Transcription Factors