Antibodies

View as table Download

Rabbit Polyclonal Anti-TAF1C Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAF1C antibody: synthetic peptide directed towards the N terminal of human TAF1C. Synthetic peptide located within the following region: MDFPSSLRPALFLTGPLGLSDVPDLSFMCSWRDALTLPEAQPQNSENGAL

Rabbit Polyclonal Anti-TAF1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAF1C antibody: synthetic peptide directed towards the C terminal of human TAF1C. Synthetic peptide located within the following region: AKLPPQRDTPGCATTPPHSQASSVRATRSQQHTPVLSSSQPLRKKPRMGF