Antibodies

Jump to Filters
View as table Download
ALG8 Rabbit Polyclonal Antibody
TA335475

USD 375.00

5 Days

Rabbit Polyclonal Anti-Alg8 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Alg8 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LELKLLDPSQIPRASMTSGLVQQSQHTVLPSVSPSATLICTLIAILPSVF
ALG8 Rabbit Polyclonal Antibody
TA323479

USD 345.00

In Stock

Anti-ALG8 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 25-122 amino acids of human ALG8, alpha-1,3-glucosyltransferase