Antibodies

View as table Download

Rabbit Polyclonal antibody to alpha Glucosidase II (glucosidase, alpha; neutral AB)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 47 and 251 of alpha Glucosidase II

Rabbit polyclonal antibody to alpha Glucosidase II (glucosidase, alpha; neutral AB)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 654 and 944 of alpha Glucosidase II (Uniprot ID#Q14697)

Rabbit Polyclonal Anti-GANAB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GANAB Antibody: synthetic peptide directed towards the middle region of human GANAB. Synthetic peptide located within the following region: IIGAGKPAAVVLQTKGSPESRLSFQHDPETSVLVLRKPGINVASDWSIHL