Antibodies

View as table Download

Goat Polyclonal Anti-FCRL1 (aa165-177) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FCRL1 (aa165-177) Antibody: Peptide with sequence C-TAEYEIPSVRESD, from the internal region of the protein sequence according to NP_443170.1; NP_001152869.1; NP_001152870.1.

FBXW7 (N-term) rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated

Rabbit polyclonal SYVN1 (HRD1) Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This SYVN1 (HRD1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 586-617 amino acids from the C-terminal region of human SYVN1 (HRD1).

Rabbit Polyclonal Anti-UBE2J2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UBE2J2 antibody: synthetic peptide directed towards the C terminal of human UBE2J2. Synthetic peptide located within the following region: GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK

Rabbit polyclonal anti-UBE2J1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to residues near the amino terminus of the human Ube2j1 protein.

Rabbit polyclonal Ubiquitin-Conjugating Enzyme E2 J2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of the human Ube2j2 protein.

Rabbit Polyclonal Anti-SYVN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SYVN1 antibody: synthetic peptide directed towards the middle region of human SYVN1. Synthetic peptide located within the following region: QGLLPPFPPGMFPLWPPMGPFPPVPPPPSSGEAVAPPSTSAALSRPSGAA

Rabbit Polyclonal Anti-SYVN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SYVN1 antibody: synthetic peptide directed towards the C terminal of human SYVN1. Synthetic peptide located within the following region: ARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVV

Anti-SYVN1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human synovial apoptosis inhibitor 1, synoviolin

Rabbit Polyclonal Anti-FBXW7 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human FBXW7