Antibodies

Jump to Filters
View as table Download
AMID (AIFM2) Rabbit Polyclonal Antibody
TA330412

USD 375.00

5 Days

Rabbit Polyclonal Anti-AIFM2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AIFM2 antibody: synthetic peptide directed towards the middle region of human AIFM2. Synthetic peptide located within the following region: GALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP
AMID (AIFM2) Rabbit Polyclonal Antibody
TA315941

USD 345.00

4 Weeks

Rabbit polyclonal anti-AIFM2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AIFM2.