Antibodies

Jump to Filters
View as table Download
OR8D4 Rabbit Polyclonal Antibody
TA332293

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR8D4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR8D4 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR8D4. Synthetic peptide located within the following region: LKPASSSSLTQEKVSSVFYTTVILMLNPLIYSLRNNEVRNALMKLLRRKI