Antibodies

Jump to Filters
View as table Download
ZnT1 (SLC30A1) Rabbit Polyclonal Antibody
TA314698

USD 345.00

4 Weeks

Rabbit polyclonal anti-SLC30A1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SLC30A1.
ZnT1 (SLC30A1) Rabbit Polyclonal Antibody
TA333727

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC30A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC30A1 Antibody: synthetic peptide directed towards the middle region of human SLC30A1. Synthetic peptide located within the following region: FCVNPCFPDPCKAFVEIINSTHASVYEAGPCWVLYLDPTLCVVMVCILLY