Antibodies

View as table Download

Rabbit Polyclonal Anti-SLC7A8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC7A8 Antibody: synthetic peptide directed towards the middle region of human SLC7A8. Synthetic peptide located within the following region: PRAIFISIPLVTFVYVFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMA

Rabbit Polyclonal Anti-SLC7A8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC7A8 antibody is: synthetic peptide directed towards the N-terminal region of Human SLC7A8. Synthetic peptide located within the following region: NNTEKKHPGGGESDASPEAGSGGGGVALKKEIGLVSACGIIVGNIIGSGI