Antibodies

Jump to Filters
View as table Download
CCR2 Rabbit Polyclonal Antibody
TA318908

USD 365.00

3 Weeks

Rabbit polyclonal anti-CCR2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding to amino acid 353 of rat CCR2
CCR2 Rabbit Polyclonal Antibody
TA329184

USD 375.00

5 Days

Rabbit Polyclonal Anti-CCR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CCR2 antibody is: synthetic peptide directed towards the N-terminal region of Human CCR2. Synthetic peptide located within the following region: RSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIF
CCR2 Mouse Monoclonal Antibody [Clone ID: 9H6]
TA354812

USD 355.00

5 Days

Mouse anti CCR-2 Monoclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated