Rabbit polyclonal anti-CCR2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding to amino acid 353 of rat CCR2 |
Rabbit polyclonal anti-CCR2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding to amino acid 353 of rat CCR2 |
Rabbit Polyclonal Anti-CCR2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CCR2 antibody is: synthetic peptide directed towards the N-terminal region of Human CCR2. Synthetic peptide located within the following region: RSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIF |
Mouse anti CCR-2 Monoclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |