SGLT2 / SLC5A4 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | SLC5A4 / SGLT2 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human SLC5A4. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Baboon, Monkey (94%); Marmoset (81%). |
Rabbit Polyclonal Anti-SLC5A4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC5A4 Antibody: synthetic peptide directed towards the N terminal of human SLC5A4. Synthetic peptide located within the following region: MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKT |
Rabbit Polyclonal Anti-SLC5A4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC5A4 Antibody: synthetic peptide directed towards the middle region of human SLC5A4. Synthetic peptide located within the following region: LLLTVVSIVWVPLVQVSQNGQLIHYTESISSYLGPPIAAVFVLAIFCKRV |
Germany
Japan
United Kingdom
China