Goat Polyclonal Antibody against ADAM33
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CQSRRCRKNAFQEL, from the internal region of the protein sequence according to NP_079496.1. |
Goat Polyclonal Antibody against ADAM33
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CQSRRCRKNAFQEL, from the internal region of the protein sequence according to NP_079496.1. |
Rabbit Polyclonal Anti-ADAM33 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADAM33 antibody: synthetic peptide directed towards the middle region of human ADAM33. Synthetic peptide located within the following region: HDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMA |