Antibodies

Jump to Filters
View as table Download
Nicotinic Acetylcholine Receptor beta 2 (CHRNB2) Goat Polyclonal Antibody
TA305621

USD 375.00

5 Days

Goat Anti-CHRNB2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence QPRHHCARQRLR, from the internal region of the protein sequence according to NP_000739.1.
Nicotinic Acetylcholine Receptor beta 2 (CHRNB2) Rabbit Polyclonal Antibody
TA338497

USD 310.00

5 Days

Rabbit Polyclonal Anti-CHRNB2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNB2 antibody: synthetic peptide directed towards the middle region of human CHRNB2. Synthetic peptide located within the following region: CKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWD
Nicotinic Acetylcholine Receptor beta 2 (CHRNB2) Rabbit Polyclonal Antibody
TA330426

USD 375.00

5 Days

Rabbit Polyclonal Anti-CHRNB2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNB2 antibody: synthetic peptide directed towards the N terminal of human CHRNB2. Synthetic peptide located within the following region: SGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISV
Nicotinic Acetylcholine Receptor beta 2 (CHRNB2) Rabbit Polyclonal Antibody
TA330427

USD 310.00

5 Days

Rabbit Polyclonal Anti-CHRNB2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNB2 antibody: synthetic peptide directed towards the N terminal of human CHRNB2. Synthetic peptide located within the following region: SGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISV
Nicotinic Acetylcholine Receptor beta 2 (CHRNB2) Rabbit Polyclonal Antibody
TA331453

USD 310.00

5 Days

Rabbit polyclonal Anti-CHRNB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNB2 antibody: synthetic peptide directed towards the middle region of human CHRNB2. Synthetic peptide located within the following region: KIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDI