Antibodies

Jump to Filters
View as table Download
Sphingomyelin Synthase 1 (SGMS1) Rabbit Polyclonal Antibody
TA329765

USD 375.00

5 Days

Rabbit polyclonal Anti-SGMS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SGMS1 antibody: synthetic peptide directed towards the middle region of human SGMS1. Synthetic peptide located within the following region: SCFVLTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMI