Antibodies

Jump to Filters
View as table Download
ABCB10 Rabbit Polyclonal Antibody
TA312752

USD 345.00

In Stock

Rabbit polyclonal anti-ABCB10 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABCB10.
ABCB10 Rabbit Polyclonal Antibody
TA332001

USD 375.00

5 Days

Rabbit Polyclonal Anti-Abcb10 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Abcb10 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NGIRVYLMQSSGQSIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSD