Antibodies

Jump to Filters
View as table Download
SCN1B Rabbit Polyclonal Antibody
TA338796

USD 375.00

5 Days

Rabbit Polyclonal Anti-Scn1b Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Scn1b antibody is: synthetic peptide directed towards the N-terminal region of Rat Scn1b. Synthetic peptide located within the following region: TFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIF
SCN1B Rabbit Polyclonal Antibody
TA351633

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-SCN1B Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SCN1B