Rabbit polyclonal antibody to Cartilage-associated protein (cartilage associated protein)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 122 and 363 of Cartilage-associated protein (Uniprot ID#O75718) |
Rabbit Polyclonal Anti-CRTAP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CRTAP antibody: synthetic peptide directed towards the N terminal of human CRTAP. Synthetic peptide located within the following region: RLFGGLLRRAHCLKRCKQGLPAFRQSQPSREVLADFQRREPYKFLQFAYF |
Germany
Japan
United Kingdom
China
