OR8D4 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 279-308 amino acids from the C-terminal region of human Olfactory receptor 8D4 |
OR8D4 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 279-308 amino acids from the C-terminal region of human Olfactory receptor 8D4 |
Rabbit Polyclonal Anti-OR8D4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OR8D4 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR8D4. Synthetic peptide located within the following region: LKPASSSSLTQEKVSSVFYTTVILMLNPLIYSLRNNEVRNALMKLLRRKI |