Rabbit polyclonal Anti-ABHD7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABHD7 antibody: synthetic peptide directed towards the N terminal of human ABHD7. Synthetic peptide located within the following region: HCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRYQLREFKSEY |
Rabbit polyclonal Anti-EPHX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EPHX4 antibody is: synthetic peptide directed towards the C-terminal region of Human EPHX4. Synthetic peptide located within the following region: QLTTEDLEAYIYVFSQPGALSGPINHYRNIFSCLPLKHHMVTTPTLLLWG |
Germany
Japan
United Kingdom
China