Antibodies

Jump to Filters
View as table Download
GALNT5 (N-term) Rabbit Polyclonal Antibody
AP51770PU-N

USD 450.00

2 Weeks

GALNT5 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 31~61 amino acids from the N-terminal region of Human GALNT5
GALNT5 Rabbit Polyclonal Antibody
TA341942

USD 375.00

5 Days

Rabbit Polyclonal Anti-GALNT5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALNT5 antibody: synthetic peptide directed towards the middle region of human GALNT5. Synthetic peptide located within the following region: ELSFKVWMCGGEIEIIPCSRVGHIFRNDNPYSFPKDRMKTVERNLVRVAE