NELL2 mouse monoclonal antibody, clone AT13E7, Purified
Applications | ELISA, WB |
Reactivities | Human, Mouse |
NELL2 mouse monoclonal antibody, clone AT13E7, Purified
Applications | ELISA, WB |
Reactivities | Human, Mouse |
NELL2 mouse monoclonal antibody, clone AT13E7, Purified
Applications | ELISA, WB |
Reactivities | Human, Mouse |
Rabbit Polyclonal Anti-NELL2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NELL2 antibody: synthetic peptide directed towards the N terminal of human NELL2. Synthetic peptide located within the following region: MESRVLLRTFCLIFGLGAVWGLGVDPSLQIDVLTELELGESTTGVRQVPG |