Antibodies

View as table Download

NELL2 mouse monoclonal antibody, clone AT13E7, Purified

Applications ELISA, WB
Reactivities Human, Mouse

NELL2 mouse monoclonal antibody, clone AT13E7, Purified

Applications ELISA, WB
Reactivities Human, Mouse

Rabbit Polyclonal Anti-NELL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NELL2 antibody: synthetic peptide directed towards the N terminal of human NELL2. Synthetic peptide located within the following region: MESRVLLRTFCLIFGLGAVWGLGVDPSLQIDVLTELELGESTTGVRQVPG