Antibodies

View as table Download

Rabbit polyclonal anti-OR6S1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR6S1.

Rabbit Polyclonal Anti-OR6S1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR6S1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR6S1. Synthetic peptide located within the following region: AIFLYVRPSQSGSVDTNWAVTVITTFVTPLLNPFIYALRNEQVKEALKDM