Rabbit Polyclonal PCDH15 Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein (NM_023115). |
Rabbit Polyclonal PCDH15 Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein (NM_023115). |
Rabbit Polyclonal PCDH15 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Anti-PCDH15 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PCDH15 antibody: synthetic peptide directed towards the N terminal of human PCDH15. Synthetic peptide located within the following region: HSIVVQVQCINKKVGTIIYHEVRIVVRDRNDNSPTFKHESYYATVNELTP |
Carrier-free (BSA/glycerol-free) PCDH15 mouse monoclonal antibody,clone OTI7F10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PCDH15 mouse monoclonal antibody,clone OTI7F10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PCDH15 mouse monoclonal antibody,clone OTI7F10, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PCDH15 mouse monoclonal antibody,clone OTI7F10, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PCDH15 mouse monoclonal antibody,clone OTI7F10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |