Antibodies

View as table Download

Rabbit Polyclonal PCDH15 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein (NM_023115).

Rabbit Polyclonal PCDH15 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal Anti-PCDH15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCDH15 antibody: synthetic peptide directed towards the N terminal of human PCDH15. Synthetic peptide located within the following region: HSIVVQVQCINKKVGTIIYHEVRIVVRDRNDNSPTFKHESYYATVNELTP

Carrier-free (BSA/glycerol-free) PCDH15 mouse monoclonal antibody,clone OTI7F10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PCDH15 mouse monoclonal antibody,clone OTI7F10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PCDH15 mouse monoclonal antibody,clone OTI7F10, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PCDH15 mouse monoclonal antibody,clone OTI7F10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated