Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-PEX10 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PEX10. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-PEX10 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PEX10 antibody: synthetic peptide directed towards the middle region of human PEX10. Synthetic peptide located within the following region: QALRPDPLRVLMSVAPSALQLRVRSLPGEDLRARVSYRLLGVISLLHLVL |
PEX10 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PEX10 |
Active filters
Target Symbol
- PEX10
Families
- Transmembrane