Rabbit polyclonal Anti-C9orf46 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C9orf46 antibody: synthetic peptide directed towards the middle region of human C9orf46. Synthetic peptide located within the following region: AIKKKKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKL |
Rabbit polyclonal Anti-C9orf46 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C9orf46 antibody: synthetic peptide directed towards the middle region of human C9orf46. Synthetic peptide located within the following region: GTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK |
Germany
Japan
United Kingdom
China