Antibodies

Jump to Filters
View as table Download
Probable hydrolase PNKD (PNKD) Rabbit Polyclonal Antibody
TA335592

USD 375.00

5 Days

Rabbit Polyclonal Anti-Pnkd Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Pnkd Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MAAVVAATALKGRGARNARVLRGILSGATANKASQNRTRALQSHSSPECK
Probable hydrolase PNKD (PNKD) (N-term) Rabbit Polyclonal Antibody
AP53364PU-N

USD 450.00

2 Weeks

Probable hydrolase PNKD (PNKD) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Bovine, Human, Mouse
Immunogen KLH conjugated synthetic peptide between 42-70 amino acids from the N-terminal region of human PNKD