Antibodies

Jump to Filters
View as table Download
SIGLEC10 Rabbit Polyclonal Antibody
TA342051

USD 375.00

5 Days

Rabbit Polyclonal Anti-SIGLEC10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIGLEC10 antibody: synthetic peptide directed towards the middle region of human SIGLEC10. Synthetic peptide located within the following region: CHVDFSRKGVSAQRTVRLRVAYAPRDLVISISRDNTPALEPQPQGNVPYL
SIGLEC10 Rabbit Polyclonal Antibody
TA351664

USD 345.00

In Stock

Rabbit Polyclonal Anti-SIGLEC10 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SIGLEC10